- Recombinant Escherichia coli Uncharacterized protein yqjD (yqjD)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1048088
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,051 Da
- E Coli or Yeast
- Uncharacterized protein yqjD (yqjD)
- 1-101
- ECK3089, JW3069
Sequence
MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDAIAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR